PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00001482-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family SRS
Protein Properties Length: 296aa    MW: 31618.6 Da    PI: 8.7237
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00001482-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702180.95.3e-56962583154
              DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklss 93 
                         sg   C+dCGn+akkdC+++ CRtCCksrg+dCathv+stWvpaa+rrer   +    + + +s +++  kr+r +    + ++s++++ +
  WALNUT_00001482-RA  96 SGMRVCRDCGNKAKKDCSYRMCRTCCKSRGYDCATHVRSTWVPAARRRERGVSMVGGDEGDGSSGSSSGVKRPRIEVLPPAITISHASTCN 186
                         57789*********************************************999999999999999*********99666666777777777 PP

              DUF702  94 aeskkeletss..........lPeevsseavfrcvrv.ssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                          ++++++ +ss          lP++v+++avfrc rv ++v +ge+e+ Yq++vsi+Gh+fkG+LydqG+e+
  WALNUT_00001482-RA 187 PTTQRSTGISSshqdasfkhsLPRQVHAKAVFRCHRVvTAVGKGEAECVYQATVSISGHLFKGFLYDQGVED 258
                         666666666666677777778***************6489******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051426.1E-5199257IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.0E-25100142IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016246.1E-21208256IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAMLGLGDLV LIAPTTSTQQ QNQYISADHH SNLSIPSSAA LGLGFGIFPL LTTTPCITAP  60
NSNNPNYWSL EKGQELSFSN NFVNGCSELM VTSIESGMRV CRDCGNKAKK DCSYRMCRTC  120
CKSRGYDCAT HVRSTWVPAA RRRERGVSMV GGDEGDGSSG SSSGVKRPRI EVLPPAITIS  180
HASTCNPTTQ RSTGISSSHQ DASFKHSLPR QVHAKAVFRC HRVVTAVGKG EAECVYQATV  240
SISGHLFKGF LYDQGVEDKN SFACISQMQL ESSIGGRNGK SSSIVSPSNA RPGSAN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003627845.11e-85LRP1 carboxy-terminal domain protein
TrEMBLG7LG161e-85G7LG16_MEDTR; LRP1 carboxy-terminal domain protein
STRINGGLYMA04G17885.13e-84(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57043154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12330.22e-52Lateral root primordium (LRP) protein-related